PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00804-snap-gene-0.42-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family MYB
Protein Properties Length: 560aa    MW: 60849.3 Da    PI: 4.8889
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00804-snap-gene-0.42-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-173986148
                                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                               +g+WT  Ed +lvd+vk++G g+W+++ ++ g+ R++k+c++rw ++l
  maker-scaffold00804-snap-gene-0.42-mRNA-1 39 KGPWTSAEDAILVDYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 86
                                               79******************************************9986 PP

2Myb_DNA-binding50.93.7e-1692135146
                                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                                +g++T+eE++ ++++++++G++ W++ a++++ gRt++++k++w++
  maker-scaffold00804-snap-gene-0.42-mRNA-1  92 KGAFTAEEEQVIIELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 135
                                                799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0733486IPR017930Myb domain
SuperFamilySSF466895.24E-3038133IPR009057Homeodomain-like
SMARTSM007174.1E-153888IPR001005SANT/Myb domain
PfamPF002493.2E-153986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-234093IPR009057Homeodomain-like
CDDcd001671.09E-114186No hitNo description
PROSITE profilePS5129425.95787141IPR017930Myb domain
SMARTSM007176.8E-1691139IPR001005SANT/Myb domain
PfamPF002496.7E-1592135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2594140IPR009057Homeodomain-like
CDDcd001678.95E-1294135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MTCKRDDSDD EMLPTDQAES PLINESSGGS SGGGSVLKKG PWTSAEDAIL VDYVKKHGEG  60
NWNAVQKHSG LFRCGKSCRL RWANHLRPNL RKGAFTAEEE QVIIELHAKM GNKWARMAAH  120
LPGRTDNEIK NYWNTRIKRR QRAGLPLYPP EVNVQAFQEG QHDQNTGGVD GEDRGQHDPL  180
QSNGYDIPDV IFDNLSANQG ILPYVPELPD ISVSNMLLKG VGSSPYCTLP PMLPRQKRFR  240
ESTDLFHGSS GSVGNGFHSF EQFRDDTCHK VARSIGLSSP LDSDPTTKNS QSFDVIQASH  300
SLSNGNSSAS EPTYGALKLE LPSLQYPETD LGSWGTSLPR PLLESVDAFI QSPPPSGAFE  360
ADCSSPRNSG LLDALLHESK TLRSVKNRSS DKSSNSSSAT PGDKADSSTL NICETEWEDC  420
GDPISPLGHS ATSLFSERTP ISACGSSLDE QQPAETFTGI AVKSEPVDPA STLDMEKETT  480
TRLNFSRPDV LLASDWLQQS SGYIKEQSIM SDAIATLLGD DLATDYKHLA SGTSISSQGW  540
GLNSCPWNNM PAVCQMSDRP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31371405107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008231582.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLM5X3T10.0M5X3T1_PRUPE; Uncharacterized protein
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-134myb domain protein 33